SCOPe 2.04: Domain d4hdob_: 4hdo B:

Lineage for d4hdob_ (4hdo B:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein automated matches [190047] (24 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186768] (124 PDB entries)

8. Domain d4hdob_: 4hdo B: [227499]
   automated match to d3cf6r_
   complexed with gnp, gol, mg

Details for d4hdob_

PDB Entry: 4hdo, 1.67 Å

PDB Description: Crystal structure of the binary Complex of KRIT1 bound to the Rap1 GTPase

PDB Compounds: (B:) Ras-related protein Rap-1b

SCOPe Domain Sequences for d4hdob_:

Sequence, based on SEQRES records:

>d4hdob_ c.37.1.8 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mreyklvvlgsggvgksaltvqfvqgifvekydptiedsyrkqvevdaqqcmleildtag
teqftamrdlymkngqgfalvysitaqstfndlqdlreqilrvkdtddvpmilvgnkcdl
edervvgkeqgqnlarqwnncaflessakskinvneifydlvrqinr

Sequence, based on observed residues (ATOM records):

>d4hdob_ c.37.1.8 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mreyklvvlgsggvgksaltvqfvqgifvekydptiedsyrkqvevdaqqcmleildtag
temrdlymkngqgfalvysitaqstfndlqdlreqilrvkdtddvpmilvgnkcdleder
vvgkeqgqnlarqwnncaflessakskinvneifydlvrqinr

Timeline for d4hdob_:

• d4hdob_ first appeared in SCOPe 2.03
  
• d4hdob_ appears in SCOPe 2.05
  
• d4hdob_ appears in the current release, SCOPe 2.08