Lineage for d4hdob_ (4hdo B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2110099Family c.37.1.8: G proteins [52592] (79 protein domains)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2111131Protein automated matches [190047] (28 species)
    not a true protein
  7. 2111209Species Human (Homo sapiens) [TaxId:9606] [186768] (168 PDB entries)
  8. 2111276Domain d4hdob_: 4hdo B: [227499]
    automated match to d3cf6r_
    complexed with gnp, gol, mg

Details for d4hdob_

PDB Entry: 4hdo (more details), 1.67 Å

PDB Description: Crystal structure of the binary Complex of KRIT1 bound to the Rap1 GTPase
PDB Compounds: (B:) Ras-related protein Rap-1b

SCOPe Domain Sequences for d4hdob_:

Sequence, based on SEQRES records: (download)

>d4hdob_ c.37.1.8 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mreyklvvlgsggvgksaltvqfvqgifvekydptiedsyrkqvevdaqqcmleildtag
teqftamrdlymkngqgfalvysitaqstfndlqdlreqilrvkdtddvpmilvgnkcdl
edervvgkeqgqnlarqwnncaflessakskinvneifydlvrqinr

Sequence, based on observed residues (ATOM records): (download)

>d4hdob_ c.37.1.8 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mreyklvvlgsggvgksaltvqfvqgifvekydptiedsyrkqvevdaqqcmleildtag
temrdlymkngqgfalvysitaqstfndlqdlreqilrvkdtddvpmilvgnkcdleder
vvgkeqgqnlarqwnncaflessakskinvneifydlvrqinr

SCOPe Domain Coordinates for d4hdob_:

Click to download the PDB-style file with coordinates for d4hdob_.
(The format of our PDB-style files is described here.)

Timeline for d4hdob_: