Lineage for d4jtna_ (4jtn A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1807020Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 1807021Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 1807502Family b.82.1.19: Cysteine dioxygenase type I [141615] (2 proteins)
    Pfam PF05995, CDO_I
  6. 1807503Protein Cysteine dioxygenase type I [141616] (4 species)
  7. 1807509Species Norway rat (Rattus norvegicus) [TaxId:10116] [159291] (21 PDB entries)
  8. 1807521Domain d4jtna_: 4jtn A: [227495]
    automated match to d3elna_
    complexed with fe2

Details for d4jtna_

PDB Entry: 4jtn (more details), 1.59 Å

PDB Description: Cysteine Dioxygenase at pH 8.0 in the presence of dithionite
PDB Compounds: (A:) Cysteine dioxygenase type 1

SCOPe Domain Sequences for d4jtna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jtna_ b.82.1.19 (A:) Cysteine dioxygenase type I {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ellkprtladlirilhelfagdevnveevqavleayesnpaewalyakfdqyrytrnlvd
qgngkfnlmilcwgeghgssihdhtdshcflkllqgnlketlfdwpdkksnemikksert
lrenqcayindsiglhrvenvshtepavslhlysppfdtchafdqrtghknkvtmtfhsk
fgirtp

SCOPe Domain Coordinates for d4jtna_:

Click to download the PDB-style file with coordinates for d4jtna_.
(The format of our PDB-style files is described here.)

Timeline for d4jtna_: