Lineage for d4ieua_ (4ieu A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1330392Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 1330393Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 1330857Family b.82.1.19: Cysteine dioxygenase type I [141615] (2 proteins)
    Pfam PF05995, CDO_I
  6. 1330858Protein Cysteine dioxygenase type I [141616] (4 species)
  7. 1330864Species Norway rat (Rattus norvegicus) [TaxId:10116] [159291] (20 PDB entries)
  8. 1330865Domain d4ieua_: 4ieu A: [227487]
    automated match to d3elna_
    complexed with 2co, fe2

Details for d4ieua_

PDB Entry: 4ieu (more details), 1.25 Å

PDB Description: Cys-persulfenate bound Cysteine Dioxygenase at pH 7.0 in the presence of Cys
PDB Compounds: (A:) Cysteine dioxygenase type 1

SCOPe Domain Sequences for d4ieua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ieua_ b.82.1.19 (A:) Cysteine dioxygenase type I {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ellkprtladlirilhelfagdevnveevqavleayesnpaewalyakfdqyrytrnlvd
qgngkfnlmilcwgeghgssihdhtdshcflkllqgnlketlfdwpdkksnemikksert
lrenqcayindsiglhrvenvshtepavslhlysppfdtchafdqrtghknkvtmtfhsk
fgirtp

SCOPe Domain Coordinates for d4ieua_:

Click to download the PDB-style file with coordinates for d4ieua_.
(The format of our PDB-style files is described here.)

Timeline for d4ieua_: