Lineage for d4iesa_ (4ies A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1330392Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 1330393Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 1330857Family b.82.1.19: Cysteine dioxygenase type I [141615] (2 proteins)
    Pfam PF05995, CDO_I
  6. 1330858Protein Cysteine dioxygenase type I [141616] (4 species)
  7. 1330864Species Norway rat (Rattus norvegicus) [TaxId:10116] [159291] (20 PDB entries)
  8. 1330868Domain d4iesa_: 4ies A: [227484]
    automated match to d3elna_
    complexed with 2co, fe

Details for d4iesa_

PDB Entry: 4ies (more details), 1.4 Å

PDB Description: Cys-persulfenate bound Cysteine Dioxygenase at pH 6.2 in the presence of Cys
PDB Compounds: (A:) Cysteine dioxygenase type 1

SCOPe Domain Sequences for d4iesa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4iesa_ b.82.1.19 (A:) Cysteine dioxygenase type I {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ellkprtladlirilhelfagdevnveevqavleayesnpaewalyakfdqyrytrnlvd
qgngkfnlmilcwgeghgssihdhtdshcflkllqgnlketlfdwpdkksnemikksert
lrenqcayindsiglhrvenvshtepavslhlysppfdtchafdqrtghknkvtmtfhsk
fgirtp

SCOPe Domain Coordinates for d4iesa_:

Click to download the PDB-style file with coordinates for d4iesa_.
(The format of our PDB-style files is described here.)

Timeline for d4iesa_: