| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins) |
| Protein automated matches [190100] (21 species) not a true protein |
| Species Ancylostoma ceylanicum [TaxId:53326] [197299] (2 PDB entries) |
| Domain d4fh8f1: 4fh8 F:1-169 [227476] Other proteins in same PDB: d4fh8a2, d4fh8b2, d4fh8d2, d4fh8f2, d4fh8h2, d4fh8j2 automated match to d4fh8d_ |
PDB Entry: 4fh8 (more details), 2.11 Å
SCOPe Domain Sequences for d4fh8f1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4fh8f1 c.47.1.10 (F:1-169) automated matches {Ancylostoma ceylanicum [TaxId: 53326]}
mskafigkpapdfatkavfdgdfvdvklsdykgkyvvlffypldftfvcpteiiafsdrf
pefknlnvavlacstdsvfshlawintprkhgglgdmkipvladtnhqiakdygvlkdde
giayrglfiidpkgilrqitindlpvgrsvdetlrlvqafqytdkhgev
Timeline for d4fh8f1: