SCOPe 2.06: Domain d4kuba1: 4kub A:1-159

Lineage for d4kuba1 (4kub A:1-159)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families)

5. Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)

6. Protein Putative acetyltransferase PA4794 [143700] (1 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [143701] (22 PDB entries)
   Uniprot Q9HV14 1-160

8. Domain d4kuba1: 4kub A:1-159 [227473]
   Other proteins in same PDB: d4kuba2
   automated match to d4klva_
   complexed with coa, edo, so4

Details for d4kuba1

PDB Entry: 4kub, 1.57 Å

PDB Description: crystal structure of a gnat superfamily acetyltransferase pa4794 in complex with coa

PDB Compounds: (A:) GNAT superfamily acetyltransferase PA4794

SCOPe Domain Sequences for d4kuba1:

Sequence; same for both SEQRES and ATOM records:

>d4kuba1 d.108.1.1 (A:1-159) Putative acetyltransferase PA4794 {Pseudomonas aeruginosa [TaxId: 287]}
mqlshrpaetgdletvagfpqdrdelfycypkaiwpfsvaqlaaaiaerrgstvavhdgq
vlgfanfyqwqhgdfcalgnmmvapaarglgvaryligvmenlareqykarlmkiscfna
naaglllytqlgyqpraiaerhdpdgrrvaliqmdkple

Timeline for d4kuba1:

• d4kuba1 first appeared in SCOPe 2.03, called d4kuba_
  
• d4kuba1 was called d4kuba_ in SCOPe 2.05
  
• d4kuba1 appears in SCOPe 2.07
  
• d4kuba1 appears in the current release, SCOPe 2.08