Lineage for d4kuba_ (4kub A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1921278Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 1921279Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 1921280Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)
  6. 1921560Protein Putative acetyltransferase PA4794 [143700] (1 species)
  7. 1921561Species Pseudomonas aeruginosa [TaxId:287] [143701] (19 PDB entries)
    Uniprot Q9HV14 1-160
  8. 1921574Domain d4kuba_: 4kub A: [227473]
    automated match to d4klva_
    complexed with coa, edo, so4

Details for d4kuba_

PDB Entry: 4kub (more details), 1.57 Å

PDB Description: crystal structure of a gnat superfamily acetyltransferase pa4794 in complex with coa
PDB Compounds: (A:) GNAT superfamily acetyltransferase PA4794

SCOPe Domain Sequences for d4kuba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kuba_ d.108.1.1 (A:) Putative acetyltransferase PA4794 {Pseudomonas aeruginosa [TaxId: 287]}
hmqlshrpaetgdletvagfpqdrdelfycypkaiwpfsvaqlaaaiaerrgstvavhdg
qvlgfanfyqwqhgdfcalgnmmvapaarglgvaryligvmenlareqykarlmkiscfn
anaaglllytqlgyqpraiaerhdpdgrrvaliqmdkple

SCOPe Domain Coordinates for d4kuba_:

Click to download the PDB-style file with coordinates for d4kuba_.
(The format of our PDB-style files is described here.)

Timeline for d4kuba_: