Lineage for d4kota_ (4kot A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2209196Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2209197Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 2209198Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)
  6. 2209481Protein Putative acetyltransferase PA4794 [143700] (1 species)
  7. 2209482Species Pseudomonas aeruginosa [TaxId:287] [143701] (22 PDB entries)
    Uniprot Q9HV14 1-160
  8. 2209498Domain d4kota_: 4kot A: [227468]
    automated match to d4klva_
    complexed with ce3, edo, so4

Details for d4kota_

PDB Entry: 4kot (more details), 1.55 Å

PDB Description: crystal structure of a gnat superfamily acetyltransferase pa4794 in complex with cefotaxime
PDB Compounds: (A:) Uncharacterized protein

SCOPe Domain Sequences for d4kota_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kota_ d.108.1.1 (A:) Putative acetyltransferase PA4794 {Pseudomonas aeruginosa [TaxId: 287]}
mqlshrpaetgdletvagfpqdrdelfycypkaiwpfsvaqlaaaiaerrgstvavhdgq
vlgfanfyqwqhgdfcalgnmmvapaarglgvaryligvmenlareqykarlmkiscfna
naaglllytqlgyqpraiaerhdpdgrrvaliqmdkple

SCOPe Domain Coordinates for d4kota_:

Click to download the PDB-style file with coordinates for d4kota_.
(The format of our PDB-style files is described here.)

Timeline for d4kota_: