Lineage for d3pcgq_ (3pcg Q:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2768597Fold b.3: Prealbumin-like [49451] (8 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2769889Superfamily b.3.6: Aromatic compound dioxygenase [49482] (2 families) (S)
  5. 2769890Family b.3.6.1: Aromatic compound dioxygenase [49483] (5 proteins)
    sandwich; 9 strands in 2 sheets
  6. 2770099Protein Protocatechuate-3,4-dioxygenase, beta chain [49489] (2 species)
  7. 2770114Species Pseudomonas putida [TaxId:303] [49490] (36 PDB entries)
  8. 2770257Domain d3pcgq_: 3pcg Q: [22746]
    Other proteins in same PDB: d3pcga_, d3pcgb_, d3pcgc_, d3pcgd_, d3pcge_, d3pcgf_
    complexed with 4hp, bme, fe

Details for d3pcgq_

PDB Entry: 3pcg (more details), 1.96 Å

PDB Description: structure of protocatechuate 3,4-dioxygenase complexed with the inhibitor 4-hydroxyphenylacetate
PDB Compounds: (Q:) protocatechuate 3,4-dioxygenase

SCOPe Domain Sequences for d3pcgq_:

Sequence, based on SEQRES records: (download)

>d3pcgq_ b.3.6.1 (Q:) Protocatechuate-3,4-dioxygenase, beta chain {Pseudomonas putida [TaxId: 303]}
paqdnsrfvirdrnwhpkaltpdyktsiarsprqalvsipqsisettgpnfshlgfgahd
hdlllnfnngglpigeriivagrvvdqygkpvpntlvemwqanaggryrhkndrylapld
pnfggvgrcltdsdgyysfrtikpgpypwrngpndwrpahihfgisgpsiatklitqlyf
egdplipmcpivksianpeavqqliakldmnnanpmdclayrfdivlrgqrkthfe

Sequence, based on observed residues (ATOM records): (download)

>d3pcgq_ b.3.6.1 (Q:) Protocatechuate-3,4-dioxygenase, beta chain {Pseudomonas putida [TaxId: 303]}
paqdnsrfvirdrnwhpkaltpdyktsiarsprqalvsipqsisettgpnfshlgfgahd
hdlllnfglpigeriivagrvvdqygkpvpntlvemwqanaggryrhkndrylapldpnf
ggvgrcltdsdgyysfrtikpgpypwrngpndwrpahihfgisgpsiatklitqlyfegd
plipmcpivksianpeavqqliakldmnnanpmdclayrfdivlrgqrkthfe

SCOPe Domain Coordinates for d3pcgq_:

Click to download the PDB-style file with coordinates for d3pcgq_.
(The format of our PDB-style files is described here.)

Timeline for d3pcgq_: