SCOPe 2.03: Domain d4ej1d_: 4ej1 D:

Lineage for d4ej1d_ (4ej1 D:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (16 species)
   not a true protein

7. Species Llama (Lama glama) [TaxId:9844] [187485] (60 PDB entries)

8. Domain d4ej1d_: 4ej1 D: [227457]
   automated match to d4eizd_
   complexed with fol, po4

Details for d4ej1d_

PDB Entry: 4ej1, 1.75 Å

PDB Description: Binding of Nb113 camelid antibody fragment with the binary DHFR:folate complex

PDB Compounds: (D:) Nb113 camelid antibody fragment

SCOPe Domain Sequences for d4ej1d_:

Sequence; same for both SEQRES and ATOM records:

>d4ej1d_ b.1.1.1 (D:) automated matches {Llama (Lama glama) [TaxId: 9844]}
qlqesggglvqaggslrlsctasgrtfssyamgwfrqtpgkerefvaaitwggsttlyad
svkgrftmsrdnakntvylqmnslkpedtavyycaadgsqyrstysfrdkpdygswgqgt
qvtvss

Timeline for d4ej1d_:

• d4ej1d_ is new in SCOPe 2.03-stable
  
• d4ej1d_ appears in SCOPe 2.04
  
• d4ej1d_ appears in the current release, SCOPe 2.08, called d4ej1d1