![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
![]() | Protein automated matches [190119] (24 species) not a true protein |
![]() | Species Llama (Lama glama) [TaxId:9844] [187485] (245 PDB entries) |
![]() | Domain d4ej1d1: 4ej1 D:3-127 [227457] Other proteins in same PDB: d4ej1a_, d4ej1b_, d4ej1c2, d4ej1d2 automated match to d4eizd_ complexed with fol, po4 |
PDB Entry: 4ej1 (more details), 1.75 Å
SCOPe Domain Sequences for d4ej1d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ej1d1 b.1.1.1 (D:3-127) automated matches {Llama (Lama glama) [TaxId: 9844]} qlqesggglvqaggslrlsctasgrtfssyamgwfrqtpgkerefvaaitwggsttlyad svkgrftmsrdnakntvylqmnslkpedtavyycaadgsqyrstysfrdkpdygswgqgt qvtvs
Timeline for d4ej1d1:
![]() Domains from other chains: (mouse over for more information) d4ej1a_, d4ej1b_, d4ej1c1, d4ej1c2 |