Lineage for d3pcgp_ (3pcg P:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 457077Fold b.3: Prealbumin-like [49451] (6 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 457416Superfamily b.3.6: Aromatic compound dioxygenase [49482] (1 family) (S)
  5. 457417Family b.3.6.1: Aromatic compound dioxygenase [49483] (4 proteins)
    sandwich; 9 strands in 2 sheets
  6. 457530Protein Protocatechuate-3,4-dioxygenase, beta chain [49489] (2 species)
  7. 457537Species Pseudomonas aeruginosa [TaxId:287] [49490] (15 PDB entries)
  8. 457547Domain d3pcgp_: 3pcg P: [22745]
    Other proteins in same PDB: d3pcga_, d3pcgb_, d3pcgc_, d3pcgd_, d3pcge_, d3pcgf_

Details for d3pcgp_

PDB Entry: 3pcg (more details), 1.96 Å

PDB Description: structure of protocatechuate 3,4-dioxygenase complexed with the inhibitor 4-hydroxyphenylacetate

SCOP Domain Sequences for d3pcgp_:

Sequence, based on SEQRES records: (download)

>d3pcgp_ b.3.6.1 (P:) Protocatechuate-3,4-dioxygenase, beta chain {Pseudomonas aeruginosa}
paqdnsrfvirdrnwhpkaltpdyktsiarsprqalvsipqsisettgpnfshlgfgahd
hdlllnfnngglpigeriivagrvvdqygkpvpntlvemwqanaggryrhkndrylapld
pnfggvgrcltdsdgyysfrtikpgpypwrngpndwrpahihfgisgpsiatklitqlyf
egdplipmcpivksianpeavqqliakldmnnanpmdclayrfdivlrgqrkthfe

Sequence, based on observed residues (ATOM records): (download)

>d3pcgp_ b.3.6.1 (P:) Protocatechuate-3,4-dioxygenase, beta chain {Pseudomonas aeruginosa}
paqdnsrfvirdrnwhpkaltpdyktsiarsprqalvsipqsisettgpnfshlgfgahd
hdlllnfglpigeriivagrvvdqygkpvpntlvemwqanaggryrhkndrylapldpnf
ggvgrcltdsdgyysfrtikpgpypwrngpndwrpahihfgisgpsiatklitqlyfegd
plipmcpivksianpeavqqliakldmnnanpmdclayrfdivlrgqrkthfe

SCOP Domain Coordinates for d3pcgp_:

Click to download the PDB-style file with coordinates for d3pcgp_.
(The format of our PDB-style files is described here.)

Timeline for d3pcgp_: