SCOPe 2.03: Domain d4ddka_: 4ddk A:

Lineage for d4ddka_ (4ddk A:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families)

5. Family c.26.1.4: Pantothenate synthetase (Pantoate-beta-alanine ligase, PanC) [63976] (2 proteins)
   contains C-terminal subdomain similar to one structural repeat of the Creatinase/aminopeptidase family
   automatically mapped to Pfam PF02569

6. Protein Pantothenate synthetase (Pantoate-beta-alanine ligase, PanC) [63977] (5 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [89615] (39 PDB entries)

8. Domain d4ddka_: 4ddk A: [227445]
   automated match to d3ivca_
   complexed with 0hn, edo, eoh, gol

Details for d4ddka_

PDB Entry: 4ddk, 1.75 Å

PDB Description: Pantothenate synthetase in complex with 1,3-benzodioxole-5-carboxylic acid

PDB Compounds: (A:) Pantothenate synthetase

SCOPe Domain Sequences for d4ddka_:

Sequence; same for both SEQRES and ATOM records:

>d4ddka_ c.26.1.4 (A:) Pantothenate synthetase (Pantoate-beta-alanine ligase, PanC) {Mycobacterium tuberculosis [TaxId: 1773]}
ipafhpgelnvysapgdvadvsralrltgrrvmlvptmgalheghlalvraakrvpgsvv
vvsifvnpmqfgaggdldayprtpdddlaqlraegveiaftpttaamypdglrttvqpgp
laaeleggprpthfagvltvvlkllqivrpdrvffgekdyqqlvlirqlvadfnldvavv
gvptvreadglamssrnryldpaqraaavalsaaltaaahaatagaqaaldaaravldaa
pgvavdylelrdiglgpmplngsgrllvaarlgttrlldniaieigtfa

Timeline for d4ddka_:

• d4ddka_ is new in SCOPe 2.03-stable
  
• d4ddka_ appears in SCOPe 2.04
  
• d4ddka_ appears in the current release, SCOPe 2.08