SCOPe 2.03: Domain d3t0la_: 3t0l A:

Lineage for d3t0la_ (3t0l A:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.7: 14-3-3 protein [48445] (1 family)
   automatically mapped to Pfam PF00244

5. Family a.118.7.1: 14-3-3 protein [48446] (5 proteins)

6. Protein automated matches [190238] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187008] (37 PDB entries)

8. Domain d3t0la_: 3t0l A: [227440]
   automated match to d3p1oa_
   complexed with 1ct, cl, gol, mg

Details for d3t0la_

PDB Entry: 3t0l, 1.6 Å

PDB Description: Small-molecule inhibitors of 14-3-3 protein-protein interactions from virtual screening

PDB Compounds: (A:) 14-3-3 protein sigma

SCOPe Domain Sequences for d3t0la_:

Sequence, based on SEQRES records:

>d3t0la_ a.118.7.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
amgsmerasliqkaklaeqaeryedmaafmkgavekgeelsceernllsvayknvvggqr
aawrvlssieqksneegseekgpevreyrekvetelqgvcdtvlglldshlikeagdaes
rvfylkmkgdyyrylaevatgddkkriidsarsayqeamdiskkempptnpirlglalnf
svfhyeianspeeaislakttfdeamadlhtlsedsykdstlimqllrdnltlwt

Sequence, based on observed residues (ATOM records):

>d3t0la_ a.118.7.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
amgsmerasliqkaklaeqaeryedmaafmkgavekgeelsceernllsvayknvvggqr
aawrvlssieqksnkgpevreyrekvetelqgvcdtvlglldshlikeagdaesrvfylk
mkgdyyrylaevatgddkkriidsarsayqeamdiskkempptnpirlglalnfsvfhye
ianspeeaislakttfdeamadlhtlsedsykdstlimqllrdnltlwt

Timeline for d3t0la_:

• d3t0la_ is new in SCOPe 2.03-stable
  
• d3t0la_ appears in SCOPe 2.04
  
• d3t0la_ appears in the current release, SCOPe 2.08, called d3t0la1