Lineage for d4b0jg_ (4b0j G:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1409951Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 1409952Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) (S)
  5. 1410079Family d.38.1.2: beta-Hydroxydecanol thiol ester dehydrase [54641] (2 proteins)
    contains two additional beta-strands in the N-terminal extension
  6. 1410090Protein automated matches [191220] (2 species)
    not a true protein
  7. 1410091Species Pseudomonas aeruginosa [TaxId:208964] [193354] (6 PDB entries)
  8. 1410120Domain d4b0jg_: 4b0j G: [227422]
    automated match to d4b0jt_
    complexed with 3mq

Details for d4b0jg_

PDB Entry: 4b0j (more details), 2.5 Å

PDB Description: crystal structure of 3-hydroxydecanoyl-acyl carrier protein dehydratase (faba) from pseudomonas aeruginosa in complex with 5-(2- thienyl)-3-isoxazolyl methanol
PDB Compounds: (G:) 3-hydroxydecanoyl-[acyl-carrier-protein] dehydratase

SCOPe Domain Sequences for d4b0jg_:

Sequence, based on SEQRES records: (download)

>d4b0jg_ d.38.1.2 (G:) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
tkqhaftredllrcsrgelfgpgnaqlpapnmlmidrivhisdvggkygkgelvaeldin
pdlwffachfegdpvmpgclgldamwqlvgfylgwqgnpgrgralgsgevkffgqvlpta
kkvtynihikrtinrslvlaiadgtvsvdgreiysaeglrvglftstdsf

Sequence, based on observed residues (ATOM records): (download)

>d4b0jg_ d.38.1.2 (G:) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
tkqhaftredllrcsrgelfgpgnaqlpapnmlmidrivhisdvggkygkgelvaeldin
pdlwffachfegdpvmpgclgldamwqlvgfylgwqgnpgrgralgsgevkffgqvlpta
kkvtynihikrtivlaiadgtvsvdgreiysaeglrvglftstdsf

SCOPe Domain Coordinates for d4b0jg_:

Click to download the PDB-style file with coordinates for d4b0jg_.
(The format of our PDB-style files is described here.)

Timeline for d4b0jg_: