Lineage for d4b0ed_ (4b0e D:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2078308Fold b.167: FimD N-terminal domain-like [141728] (1 superfamily)
    pseudo barrel, capped by an alpha-helix; some topological similarity to the PRC-barrel domain (50346) and the N-terminal domain of Glutamine synthetase (54368)
  4. 2078309Superfamily b.167.1: FimD N-terminal domain-like [141729] (2 families) (S)
    automatically mapped to Pfam PF13954
  5. 2078317Family b.167.1.0: automated matches [227281] (1 protein)
    not a true family
  6. 2078318Protein automated matches [227092] (1 species)
    not a true protein
  7. 2078319Species Yersinia pestis [TaxId:632] [226478] (2 PDB entries)
  8. 2078321Domain d4b0ed_: 4b0e D: [227415]
    automated match to d4b0ma_

Details for d4b0ed_

PDB Entry: 4b0e (more details), 2 Å

PDB Description: Crystal structure of the Caf1A usher protein N-terminal domain from Yersinia pestis
PDB Compounds: (D:) F1 capsule-anchoring protein

SCOPe Domain Sequences for d4b0ed_:

Sequence, based on SEQRES records: (download)

>d4b0ed_ b.167.1.0 (D:) automated matches {Yersinia pestis [TaxId: 632]}
dvslfnqglqlpgnyfvnvfvngrkvdsgnidfrlekhngkellwpclsslqltkygidi
dkypdliksgteqcvdllaiphsdvqfyfnqqklslivppqallp

Sequence, based on observed residues (ATOM records): (download)

>d4b0ed_ b.167.1.0 (D:) automated matches {Yersinia pestis [TaxId: 632]}
dvslfnqglqlpgnyfvnvfvngrkvdsgnidfrlekhngkellwpclsslqltkygidi
dkypdliqcvdllaiphsdvqfyfnqqklslivppqallp

SCOPe Domain Coordinates for d4b0ed_:

Click to download the PDB-style file with coordinates for d4b0ed_.
(The format of our PDB-style files is described here.)

Timeline for d4b0ed_: