SCOPe 2.08: Domain d4b9fa_: 4b9f A:

Lineage for d4b9fa_ (4b9f A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families)

5. Family b.2.2.2: Cellulose-binding domain family III [49390] (9 proteins)
   Pfam PF00963

6. Protein Cellusomal scaffolding protein A, scaffoldin [49391] (3 species)

7. Species Clostridium thermocellum [TaxId:203119] [194716] (1 PDB entry)

8. Domain d4b9fa_: 4b9f A: [227414]
   automated match to d4b9fb_
   complexed with ca, so4

Details for d4b9fa_

PDB Entry: 4b9f, 1.19 Å

PDB Description: High resolution structure for family 3a carbohydrate binding module from the cipA scaffolding of clostridium thermocellum

PDB Compounds: (A:) Cellulosomal-scaffolding protein A

SCOPe Domain Sequences for d4b9fa_:

Sequence; same for both SEQRES and ATOM records:

>d4b9fa_ b.2.2.2 (A:) Cellusomal scaffolding protein A, scaffoldin {Clostridium thermocellum [TaxId: 203119]}
nlkvefynsnpsdttnsinpqfkvtntgssaidlskltlryyytvdgqkdqtfwcdhaai
igsngsyngitsnvkgtfvkmssstnnadtyleisftggtlepgahvqiqgrfakndwsn
ytqsndysfksasqfvewdqvtaylngvlvwg

Timeline for d4b9fa_:

• d4b9fa_ first appeared in SCOPe 2.03
  
• d4b9fa_ appears in SCOPe 2.07