![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
![]() | Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) ![]() shares functional and structural similarities with the ATP-grasp fold and PIPK |
![]() | Family d.144.1.0: automated matches [191359] (1 protein) not a true family |
![]() | Protein automated matches [190417] (37 species) not a true protein |
![]() | Species Acinetobacter baumannii [TaxId:509173] [227366] (8 PDB entries) |
![]() | Domain d4gkhj_: 4gkh J: [227412] automated match to d3tm0a_ complexed with 0j9, act, cl, kan, na, peg |
PDB Entry: 4gkh (more details), 1.86 Å
SCOPe Domain Sequences for d4gkhj_:
Sequence, based on SEQRES records: (download)
>d4gkhj_ d.144.1.0 (J:) automated matches {Acinetobacter baumannii [TaxId: 509173]} mshiqretscsrprlnsnldadlygyrwardnvgqsgatiyrlygkpnapelflkhgkgs vandvtdemvrlnwltafmplptikhfirtpddawllttaipgktafqvleeypdsgeni vdalavflrrlhsipvcncpfnsdrvfrlaqaqsrmnnglvdasdfdderngwpveqvwk emhkllpfspdsvvthgdfsldnlifdegkligcidvgrvgiadryqdlailwnclgefs pslqkrlfqkygidnpdmnklqfhlmldeff
>d4gkhj_ d.144.1.0 (J:) automated matches {Acinetobacter baumannii [TaxId: 509173]} mshiqretscsrprlnsnldadlygyrwardngatiyrlygkpnapelflkhgkgsvand vtdemvrlnwltafmplptikhfirtpddawllttaipgktafqvleeypdsgenivdal avflrrlhsipvcncpfnsdrvfrlaqaqsrmnnglvdasdfdderngwpveqvwkemhk llpfspdsvvthgdfsldnlifdegkligcidvgrvgiadryqdlailwnclgefspslq krlfqkygidnpdmnklqfhlmldeff
Timeline for d4gkhj_: