Lineage for d4gkhc_ (4gkh C:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1433536Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1433537Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1436359Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. 1436360Protein automated matches [190417] (18 species)
    not a true protein
  7. 1436361Species Acinetobacter baumannii [TaxId:509173] [227366] (7 PDB entries)
  8. 1436370Domain d4gkhc_: 4gkh C: [227408]
    automated match to d3tm0a_
    complexed with 0j9, act, cl, kan, na, peg

Details for d4gkhc_

PDB Entry: 4gkh (more details), 1.86 Å

PDB Description: Crystal structure of the aminoglycoside phosphotransferase APH(3')-Ia, with substrate kanamycin and small molecule inhibitor 1-NA-PP1
PDB Compounds: (C:) Aminoglycoside 3'-phosphotransferase AphA1-IAB

SCOPe Domain Sequences for d4gkhc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gkhc_ d.144.1.0 (C:) automated matches {Acinetobacter baumannii [TaxId: 509173]}
qretscsrprlnsnldadlygyrwardnvgqsgatiyrlygkpnapelflkhgkgsvand
vtdemvrlnwltafmplptikhfirtpddawllttaipgktafqvleeypdsgenivdal
avflrrlhsipvcncpfnsdrvfrlaqaqsrmnnglvdasdfdderngwpveqvwkemhk
llpfspdsvvthgdfsldnlifdegkligcidvgrvgiadryqdlailwnclgefspslq
krlfqkygidnpdmnklqfhlmldeff

SCOPe Domain Coordinates for d4gkhc_:

Click to download the PDB-style file with coordinates for d4gkhc_.
(The format of our PDB-style files is described here.)

Timeline for d4gkhc_: