Lineage for d4gkik_ (4gki K:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2586062Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2586063Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2591262Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. 2591263Protein automated matches [190417] (35 species)
    not a true protein
  7. 2591264Species Acinetobacter baumannii [TaxId:509173] [227366] (8 PDB entries)
  8. 2591293Domain d4gkik_: 4gki K: [227401]
    Other proteins in same PDB: d4gkia2, d4gkic2, d4gkig2, d4gkij2
    automated match to d3tm0a_
    complexed with 0jn, act, cl, kan, na, peg

Details for d4gkik_

PDB Entry: 4gki (more details), 1.88 Å

PDB Description: Crystal structure of the aminoglycoside phosphotransferase APH(3')-Ia, with substrate kanamycin and small molecule inhibitor 1-NM-PP1
PDB Compounds: (K:) Aminoglycoside 3'-phosphotransferase AphA1-IAB

SCOPe Domain Sequences for d4gkik_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gkik_ d.144.1.0 (K:) automated matches {Acinetobacter baumannii [TaxId: 509173]}
mshiqretscsrprlnsnldadlygyrwardnvgqsgatiyrlygkpnapelflkhgkgs
vandvtdemvrlnwltafmplptikhfirtpddawllttaipgktafqvleeypdsgeni
vdalavflrrlhsipvcncpfnsdrvfrlaqaqsrmnnglvdasdfdderngwpveqvwk
emhkllpfspdsvvthgdfsldnlifdegkligcidvgrvgiadryqdlailwnclgefs
pslqkrlfqkygidnpdmnklqfhlmldeff

SCOPe Domain Coordinates for d4gkik_:

Click to download the PDB-style file with coordinates for d4gkik_.
(The format of our PDB-style files is described here.)

Timeline for d4gkik_: