SCOPe 2.08: Domain d4gkij1: 4gki J:1-271

Lineage for d4gkij1 (4gki J:1-271)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.0: automated matches [191359] (1 protein)
   not a true family

6. Protein automated matches [190417] (37 species)
   not a true protein

7. Species Acinetobacter baumannii [TaxId:509173] [227366] (8 PDB entries)

8. Domain d4gkij1: 4gki J:1-271 [227400]
   Other proteins in same PDB: d4gkia2, d4gkic2, d4gkig2, d4gkij2
   automated match to d3tm0a_
   complexed with 0jn, act, cl, kan, na, peg

Details for d4gkij1

PDB Entry: 4gki, 1.88 Å

PDB Description: Crystal structure of the aminoglycoside phosphotransferase APH(3')-Ia, with substrate kanamycin and small molecule inhibitor 1-NM-PP1

PDB Compounds: (J:) Aminoglycoside 3'-phosphotransferase AphA1-IAB

SCOPe Domain Sequences for d4gkij1:

Sequence; same for both SEQRES and ATOM records:

>d4gkij1 d.144.1.0 (J:1-271) automated matches {Acinetobacter baumannii [TaxId: 509173]}
mshiqretscsrprlnsnldadlygyrwardnvgqsgatiyrlygkpnapelflkhgkgs
vandvtdemvrlnwltafmplptikhfirtpddawllttaipgktafqvleeypdsgeni
vdalavflrrlhsipvcncpfnsdrvfrlaqaqsrmnnglvdasdfdderngwpveqvwk
emhkllpfspdsvvthgdfsldnlifdegkligcidvgrvgiadryqdlailwnclgefs
pslqkrlfqkygidnpdmnklqfhlmldeff

Timeline for d4gkij1:

• d4gkij1 first appeared in SCOPe 2.03, called d4gkij_
  
• d4gkij1 appears in SCOPe 2.07