Lineage for d4gkic_ (4gki C:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1929110Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1929111Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1932524Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. 1932525Protein automated matches [190417] (21 species)
    not a true protein
  7. 1932526Species Acinetobacter baumannii [TaxId:509173] [227366] (7 PDB entries)
  8. 1932547Domain d4gkic_: 4gki C: [227396]
    automated match to d3tm0a_
    complexed with 0jn, act, cl, kan, na, peg

Details for d4gkic_

PDB Entry: 4gki (more details), 1.88 Å

PDB Description: Crystal structure of the aminoglycoside phosphotransferase APH(3')-Ia, with substrate kanamycin and small molecule inhibitor 1-NM-PP1
PDB Compounds: (C:) Aminoglycoside 3'-phosphotransferase AphA1-IAB

SCOPe Domain Sequences for d4gkic_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gkic_ d.144.1.0 (C:) automated matches {Acinetobacter baumannii [TaxId: 509173]}
gmshiqretscsrprlnsnldadlygyrwardnvgqsgatiyrlygkpnapelflkhgkg
svandvtdemvrlnwltafmplptikhfirtpddawllttaipgktafqvleeypdsgen
ivdalavflrrlhsipvcncpfnsdrvfrlaqaqsrmnnglvdasdfdderngwpveqvw
kemhkllpfspdsvvthgdfsldnlifdegkligcidvgrvgiadryqdlailwnclgef
spslqkrlfqkygidnpdmnklqfhlmldeff

SCOPe Domain Coordinates for d4gkic_:

Click to download the PDB-style file with coordinates for d4gkic_.
(The format of our PDB-style files is described here.)

Timeline for d4gkic_: