![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
![]() | Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) ![]() shares functional and structural similarities with the ATP-grasp fold and PIPK |
![]() | Family d.144.1.0: automated matches [191359] (1 protein) not a true family |
![]() | Protein automated matches [190417] (18 species) not a true protein |
![]() | Species Acinetobacter baumannii [TaxId:509173] [227366] (7 PDB entries) |
![]() | Domain d4gkif_: 4gki F: [227392] automated match to d3tm0a_ complexed with 0jn, act, cl, kan, na, peg |
PDB Entry: 4gki (more details), 1.88 Å
SCOPe Domain Sequences for d4gkif_:
Sequence, based on SEQRES records: (download)
>d4gkif_ d.144.1.0 (F:) automated matches {Acinetobacter baumannii [TaxId: 509173]} hiqretscsrprlnsnldadlygyrwardnvgqsgatiyrlygkpnapelflkhgkgsva ndvtdemvrlnwltafmplptikhfirtpddawllttaipgktafqvleeypdsgenivd alavflrrlhsipvcncpfnsdrvfrlaqaqsrmnnglvdasdfdderngwpveqvwkem hkllpfspdsvvthgdfsldnlifdegkligcidvgrvgiadryqdlailwnclgefsps lqkrlfqkygidnpdmnklqfhlmldeff
>d4gkif_ d.144.1.0 (F:) automated matches {Acinetobacter baumannii [TaxId: 509173]} hiqretscsrprldadlygyrwardngatiyrlygkpnapelflkhgkgsvandvtdemv rlnwltafmplptikhfirtpddawllttaipgktafqvleeypdsgenivdalavflrr lhsipvcncpfnsdrvfrlaqaqsrmnnglvdasdfdderngwpveqvwkemhkllpfsp dsvvthgdfsldnlifdegkligcidvgrvgiadryqdlailwnclgefspslqkrlfqk ygidnpdmnklqfhlmldeff
Timeline for d4gkif_: