| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) ![]() shares functional and structural similarities with the ATP-grasp fold and PIPK |
| Family d.144.1.0: automated matches [191359] (1 protein) not a true family |
| Protein automated matches [190417] (35 species) not a true protein |
| Species Acinetobacter baumannii [TaxId:509173] [227366] (8 PDB entries) |
| Domain d4fevc_: 4fev C: [227389] automated match to d3tm0a_ complexed with act, kan, na, pp1 |
PDB Entry: 4fev (more details), 1.89 Å
SCOPe Domain Sequences for d4fevc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4fevc_ d.144.1.0 (C:) automated matches {Acinetobacter baumannii [TaxId: 509173]}
nldadlygyrwardnvgqsgatiyrlygkpnapelflkhgkgsvandvtdemvrlnwlta
fmplptikhfirtpddawllttaipgktafqvleeypdsgenivdalavflrrlhsipvc
ncpfnsdrvfrlaqaqsrmnnglvdasdfdderngwpveqvwkemhkllpfspdsvvthg
dfsldnlifdegkligcidvgrvgiadryqdlailwnclgefspslqkrlfqkygidnpd
mnklqfhlmldeff
Timeline for d4fevc_: