Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.0: automated matches [191359] (1 protein) not a true family |
Protein automated matches [190417] (35 species) not a true protein |
Species Acinetobacter baumannii [TaxId:509173] [227366] (8 PDB entries) |
Domain d4feud_: 4feu D: [227378] automated match to d3tm0a_ complexed with 537, act, kan |
PDB Entry: 4feu (more details), 2.37 Å
SCOPe Domain Sequences for d4feud_:
Sequence, based on SEQRES records: (download)
>d4feud_ d.144.1.0 (D:) automated matches {Acinetobacter baumannii [TaxId: 509173]} gyrwardnvgqsgatiyrlygkpnapelflkhgkgsvandvtdemvrlnwltafmplpti khfirtpddawllttaipgktafqvleeypdsgenivdalavflrrlhsipvcncpfnsd rvfrlaqaqsrmnnglvdasdfdderngwpveqvwkemhkllpfspdsvvthgdfsldnl ifdegkligcidvgrvgiadryqdlailwnclgefspslqkrlfqkygidnpdmnklqfh lmldeff
>d4feud_ d.144.1.0 (D:) automated matches {Acinetobacter baumannii [TaxId: 509173]} gyrwardgatiyrlygkpnapelflkhgkgsvandvtdemvrlnwltafmplptikhfir tpddawllttaipgktafqvleeypdsgenivdalavflrrlhsipvcncpfnsdrvfrl aqaqsrmnnglvdasdfdderngwpveqvwkemhkllpfspdsvvthgdfsldnlifdeg kligcidvgrvgiadryqdlailwnclgefspslqkrlfqkygidnpdmnklqfhlmlde ff
Timeline for d4feud_: