| Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
| Fold d.139: PurM C-terminal domain-like [56041] (1 superfamily) 3 layers: alpha/beta/alpha; partial topological similarity to the ferredoxin-like fold |
Superfamily d.139.1: PurM C-terminal domain-like [56042] (2 families) ![]() |
| Family d.139.1.1: PurM C-terminal domain-like [56043] (6 proteins) |
| Protein FGAM synthase PurL, PurM-like module, C1 and C2 domains [111181] (3 species) |
| Species Salmonella enterica [TaxId:90371] [227353] (2 PDB entries) |
| Domain d3ugja6: 3ugj A:817-1033 [227364] Other proteins in same PDB: d3ugja1, d3ugja2, d3ugja3, d3ugja5, d3ugja7 automated match to d1t3ta7 complexed with adp, mg, so4 |
PDB Entry: 3ugj (more details), 1.78 Å
SCOPe Domain Sequences for d3ugja6:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ugja6 d.139.1.1 (A:817-1033) FGAM synthase PurL, PurM-like module, C1 and C2 domains {Salmonella enterica [TaxId: 90371]}
pqlstednalllidlgkghnalgatalaqvyrqlgdkpadvrdvaqlkgfydamqalvaa
rkllawhdrsdggllvtlaemafaghcgvqvdiaalgddhlaalfneelggviqvraedr
daveallaqygladcvhylgqalagdrfvitandqtvfsesrttlrvwwaettwqmqrlr
dnpqcadqeheakandtdpglnvklsfdinediaapy
Timeline for d3ugja6: