Lineage for d3ugja6 (3ugj A:817-1033)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1928072Fold d.139: PurM C-terminal domain-like [56041] (1 superfamily)
    3 layers: alpha/beta/alpha; partial topological similarity to the ferredoxin-like fold
  4. 1928073Superfamily d.139.1: PurM C-terminal domain-like [56042] (2 families) (S)
  5. 1928074Family d.139.1.1: PurM C-terminal domain-like [56043] (6 proteins)
  6. 1928084Protein FGAM synthase PurL, PurM-like module, C1 and C2 domains [111181] (3 species)
  7. 1928085Species Salmonella enterica [TaxId:90371] [227353] (2 PDB entries)
  8. 1928087Domain d3ugja6: 3ugj A:817-1033 [227364]
    Other proteins in same PDB: d3ugja1, d3ugja2, d3ugja3, d3ugja5, d3ugja7
    automated match to d1t3ta7
    complexed with adp, mg, so4

Details for d3ugja6

PDB Entry: 3ugj (more details), 1.78 Å

PDB Description: formyl glycinamide ribonucletide amidotransferase from salmonella typhimurum: role of the atp complexation and glutaminase domain in catalytic coupling
PDB Compounds: (A:) Phosphoribosylformylglycinamidine synthase

SCOPe Domain Sequences for d3ugja6:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ugja6 d.139.1.1 (A:817-1033) FGAM synthase PurL, PurM-like module, C1 and C2 domains {Salmonella enterica [TaxId: 90371]}
pqlstednalllidlgkghnalgatalaqvyrqlgdkpadvrdvaqlkgfydamqalvaa
rkllawhdrsdggllvtlaemafaghcgvqvdiaalgddhlaalfneelggviqvraedr
daveallaqygladcvhylgqalagdrfvitandqtvfsesrttlrvwwaettwqmqrlr
dnpqcadqeheakandtdpglnvklsfdinediaapy

SCOPe Domain Coordinates for d3ugja6:

Click to download the PDB-style file with coordinates for d3ugja6.
(The format of our PDB-style files is described here.)

Timeline for d3ugja6: