SCOPe 2.04: Domain d3ugja6: 3ugj A:817-1033

Lineage for d3ugja6 (3ugj A:817-1033)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.139: PurM C-terminal domain-like [56041] (1 superfamily)
   3 layers: alpha/beta/alpha; partial topological similarity to the ferredoxin-like fold

4. Superfamily d.139.1: PurM C-terminal domain-like [56042] (2 families)

5. Family d.139.1.1: PurM C-terminal domain-like [56043] (6 proteins)

6. Protein FGAM synthase PurL, PurM-like module, C1 and C2 domains [111181] (3 species)

7. Species Salmonella enterica [TaxId:90371] [227353] (2 PDB entries)

8. Domain d3ugja6: 3ugj A:817-1033 [227364]
   Other proteins in same PDB: d3ugja1, d3ugja2, d3ugja3, d3ugja5, d3ugja7
   automated match to d1t3ta7
   complexed with adp, mg, so4

Details for d3ugja6

PDB Entry: 3ugj, 1.78 Å

PDB Description: formyl glycinamide ribonucletide amidotransferase from salmonella typhimurum: role of the atp complexation and glutaminase domain in catalytic coupling

PDB Compounds: (A:) Phosphoribosylformylglycinamidine synthase

SCOPe Domain Sequences for d3ugja6:

Sequence; same for both SEQRES and ATOM records:

>d3ugja6 d.139.1.1 (A:817-1033) FGAM synthase PurL, PurM-like module, C1 and C2 domains {Salmonella enterica [TaxId: 90371]}
pqlstednalllidlgkghnalgatalaqvyrqlgdkpadvrdvaqlkgfydamqalvaa
rkllawhdrsdggllvtlaemafaghcgvqvdiaalgddhlaalfneelggviqvraedr
daveallaqygladcvhylgqalagdrfvitandqtvfsesrttlrvwwaettwqmqrlr
dnpqcadqeheakandtdpglnvklsfdinediaapy

Timeline for d3ugja6:

• d3ugja6 first appeared in SCOPe 2.03
  
• d3ugja6 appears in SCOPe 2.05
  
• d3ugja6 appears in the current release, SCOPe 2.08