Lineage for d3pccm_ (3pcc M:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 659818Fold b.3: Prealbumin-like [49451] (7 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 660205Superfamily b.3.6: Aromatic compound dioxygenase [49482] (1 family) (S)
  5. 660206Family b.3.6.1: Aromatic compound dioxygenase [49483] (4 proteins)
    sandwich; 9 strands in 2 sheets
  6. 660362Protein Protocatechuate-3,4-dioxygenase, beta chain [49489] (2 species)
  7. 660376Species Pseudomonas aeruginosa [TaxId:287] [49490] (15 PDB entries)
  8. 660437Domain d3pccm_: 3pcc M: [22736]
    Other proteins in same PDB: d3pcca_, d3pccb_, d3pccc_, d3pccd_, d3pcce_, d3pccf_

Details for d3pccm_

PDB Entry: 3pcc (more details), 1.98 Å

PDB Description: structure of protocatechuate 3,4-dioxygenase complexed with 4- hydroxybenzoate
PDB Compounds: (M:) protocatechuate 3,4-dioxygenase

SCOP Domain Sequences for d3pccm_:

Sequence, based on SEQRES records: (download)

>d3pccm_ b.3.6.1 (M:) Protocatechuate-3,4-dioxygenase, beta chain {Pseudomonas aeruginosa [TaxId: 287]}
paqdnsrfvirdrnwhpkaltpdyktsiarsprqalvsipqsisettgpnfshlgfgahd
hdlllnfnngglpigeriivagrvvdqygkpvpntlvemwqanaggryrhkndrylapld
pnfggvgrcltdsdgyysfrtikpgpypwrngpndwrpahihfgisgpsiatklitqlyf
egdplipmcpivksianpeavqqliakldmnnanpmdclayrfdivlrgqrkthfe

Sequence, based on observed residues (ATOM records): (download)

>d3pccm_ b.3.6.1 (M:) Protocatechuate-3,4-dioxygenase, beta chain {Pseudomonas aeruginosa [TaxId: 287]}
paqdnsrfvirdrnwhpkaltpdyktsiarsprqalvsipqsisettgpnfshlgfgahd
hdlllnfglpigeriivagrvvdqygkpvpntlvemwqanaggryrhkndrylapldpnf
ggvgrcltdsdgyysfrtikpgpypwrngpndwrpahihfgisgpsiatklitqlyfegd
plipmcpivksianpeavqqliakldmnnanpmdclayrfdivlrgqrkthfe

SCOP Domain Coordinates for d3pccm_:

Click to download the PDB-style file with coordinates for d3pccm_.
(The format of our PDB-style files is described here.)

Timeline for d3pccm_: