SCOPe 2.07: Domain d3ugja1: 3ugj A:1-152

Lineage for d3ugja1 (3ugj A:1-152)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.284: PurS-like [109622] (1 superfamily)
   consists of two alpha+beta subdomains with some similarity to the ferredoxin-like fold

4. Superfamily d.284.1: PurS-like [82697] (3 families)
   segment-swapped dimer: the swapped segment is made of the first helix and second strand; a single long strand is formed by strands 2 and 3 of each subunit

5. Family d.284.1.2: FGAM synthase PurL, PurS-like domain [111002] (1 protein)
   duplication: consists of 2 structural repeats of the PurS subunit fold, assembled like the PurS dimer

6. Protein FGAM synthase PurL, PurS-like domain [111003] (3 species)

7. Species Salmonella enterica [TaxId:90371] [227347] (2 PDB entries)

8. Domain d3ugja1: 3ugj A:1-152 [227359]
   Other proteins in same PDB: d3ugja2, d3ugja3, d3ugja4, d3ugja5, d3ugja6, d3ugja7, d3ugja8
   automated match to d1t3ta3
   complexed with adp, mg, so4

Details for d3ugja1

PDB Entry: 3ugj, 1.78 Å

PDB Description: formyl glycinamide ribonucletide amidotransferase from salmonella typhimurum: role of the atp complexation and glutaminase domain in catalytic coupling

PDB Compounds: (A:) Phosphoribosylformylglycinamidine synthase

SCOPe Domain Sequences for d3ugja1:

Sequence; same for both SEQRES and ATOM records:

>d3ugja1 d.284.1.2 (A:1-152) FGAM synthase PurL, PurS-like domain {Salmonella enterica [TaxId: 90371]}
mmeilrgspalsafrinkllarfqaanlqvhniyaeyvhfadlnaplndseqaqltrllq
ygpalsshtpagklllvtprpgtispwsskatdiahncglqqvdrlergvayyieastlt
aeqwrqvaaelhdrmmetvfssltdaeklfih

Timeline for d3ugja1:

• d3ugja1 first appeared in SCOPe 2.03
  
• d3ugja1 appears in SCOPe 2.06
  
• d3ugja1 appears in the current release, SCOPe 2.08