Lineage for d3ujna5 (3ujn A:617-816)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1914038Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 1914717Superfamily d.79.4: PurM N-terminal domain-like [55326] (2 families) (S)
  5. 1914718Family d.79.4.1: PurM N-terminal domain-like [55327] (7 proteins)
  6. 1914728Protein FGAM synthase PurL, PurM-like module, N1 and N2 domains [111035] (3 species)
  7. 1914729Species Salmonella enterica [TaxId:90371] [227351] (2 PDB entries)
  8. 1914733Domain d3ujna5: 3ujn A:617-816 [227355]
    Other proteins in same PDB: d3ujna1, d3ujna2, d3ujna4, d3ujna6, d3ujna7
    automated match to d1t3ta5
    complexed with adp, mg, so4

Details for d3ujna5

PDB Entry: 3ujn (more details), 2.98 Å

PDB Description: Formyl Glycinamide Ribonucleotide Amidotransferase from Salmonella Typhimurium : Role of the ATP complexation and glutaminase domain in catalytic coupling
PDB Compounds: (A:) Phosphoribosylformylglycinamidine synthase

SCOPe Domain Sequences for d3ujna5:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ujna5 d.79.4.1 (A:617-816) FGAM synthase PurL, PurM-like module, N1 and N2 domains {Salmonella enterica [TaxId: 90371]}
qtlkakgdalnraditiadavkrvlhlptvaektflvtigdrtvtgmvardqmvgpwqvp
vadcavttasldsyygeamsigerapvalldfaasarlavgealtniaatqigdikrikl
sanwmaaaghpgedaglydavkavgeelcpqlgltipvgkdsmsmktrwqegneqremts
plslvisafarvedvrhtlt

SCOPe Domain Coordinates for d3ujna5:

Click to download the PDB-style file with coordinates for d3ujna5.
(The format of our PDB-style files is described here.)

Timeline for d3ujna5: