Class b: All beta proteins [48724] (177 folds) |
Fold b.3: Prealbumin-like [49451] (7 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
Superfamily b.3.6: Aromatic compound dioxygenase [49482] (2 families) |
Family b.3.6.1: Aromatic compound dioxygenase [49483] (5 proteins) sandwich; 9 strands in 2 sheets |
Protein Protocatechuate-3,4-dioxygenase, alpha chain [49486] (2 species) alpha and beta chains are derived from a single-chain protomer and share this fold |
Species Acinetobacter calcoaceticus, adp1 [TaxId:471] [49488] (6 PDB entries) |
Domain d1eoca_: 1eoc A: [22735] Other proteins in same PDB: d1eocb_ complexed with 4nc, fe |
PDB Entry: 1eoc (more details), 2.25 Å
SCOPe Domain Sequences for d1eoca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eoca_ b.3.6.1 (A:) Protocatechuate-3,4-dioxygenase, alpha chain {Acinetobacter calcoaceticus, adp1 [TaxId: 471]} elketpsqtggpyvhigllpkqanievfehnldnnlvqdntqgqrirlegqvfdglglpl rdvlieiwqadtngvypsqadtqgkqvdpnflgwgrtgadfgtgfwsfntikpgavpgrk gstqaphisliifarginiglhtrvyfddeaeanakdpvlnsiewatrrqtlvakreerd gevvyrfdiriqgenetvffdi
Timeline for d1eoca_: