Lineage for d3qxvc_ (3qxv C:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1287435Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1289963Protein automated matches [190119] (16 species)
    not a true protein
  7. 1290216Species Llama (Lama glama) [TaxId:9844] [187485] (60 PDB entries)
  8. 1290316Domain d3qxvc_: 3qxv C: [227345]
    automated match to d3qxve_
    complexed with mtx, so4

Details for d3qxvc_

PDB Entry: 3qxv (more details), 2.5 Å

PDB Description: Structure of an Anti-Methotrexate CDR1-4 Graft VHH Antibody in Complex with Methotrexate
PDB Compounds: (C:) Anti-Methotrexate CDR1-4 Graft VHH

SCOPe Domain Sequences for d3qxvc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qxvc_ b.1.1.1 (C:) automated matches {Llama (Lama glama) [TaxId: 9844]}
vqlvesggglvqaggslrlscaasrrssrswamawfrqapgkerefvakisgdgrlttyg
dsvkgrftisrdnaeylvylqmdslkpedtavyycaaddnyvtaswrsgpdywgqgtqvt
vss

SCOPe Domain Coordinates for d3qxvc_:

Click to download the PDB-style file with coordinates for d3qxvc_.
(The format of our PDB-style files is described here.)

Timeline for d3qxvc_: