Lineage for d3qxvd_ (3qxv D:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2021376Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2023921Protein automated matches [190119] (22 species)
    not a true protein
  7. 2024425Species Llama (Lama glama) [TaxId:9844] [187485] (138 PDB entries)
  8. 2024586Domain d3qxvd_: 3qxv D: [227342]
    automated match to d3qxve_
    complexed with mtx, so4

Details for d3qxvd_

PDB Entry: 3qxv (more details), 2.5 Å

PDB Description: Structure of an Anti-Methotrexate CDR1-4 Graft VHH Antibody in Complex with Methotrexate
PDB Compounds: (D:) Anti-Methotrexate CDR1-4 Graft VHH

SCOPe Domain Sequences for d3qxvd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qxvd_ b.1.1.1 (D:) automated matches {Llama (Lama glama) [TaxId: 9844]}
qvqlvesggglvqaggslrlscaasrrssrswamawfrqapgkerefvakisgdgrltty
gdsvkgrftisrdnaeylvylqmdslkpedtavyycaaddnyvtaswrsgpdywgqgtqv
tvss

SCOPe Domain Coordinates for d3qxvd_:

Click to download the PDB-style file with coordinates for d3qxvd_.
(The format of our PDB-style files is described here.)

Timeline for d3qxvd_: