![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
![]() | Protein automated matches [190119] (24 species) not a true protein |
![]() | Species Llama (Lama glama) [TaxId:9844] [187485] (245 PDB entries) |
![]() | Domain d3qxwc_: 3qxw C: [227341] automated match to d3qxve_ complexed with na, so4 |
PDB Entry: 3qxw (more details), 1.85 Å
SCOPe Domain Sequences for d3qxwc_:
Sequence, based on SEQRES records: (download)
>d3qxwc_ b.1.1.1 (C:) automated matches {Llama (Lama glama) [TaxId: 9844]} vqlvesggglvqaggslrlscaasrrssrswamawfrqapgkerefvakisgdgrlttyg dsvkgrftisrdnaeylvylqmdslkpedtavyycaaddnyvtaswrsgpdywgqgtqvt vss
>d3qxwc_ b.1.1.1 (C:) automated matches {Llama (Lama glama) [TaxId: 9844]} vqlvesggglvqaggslrlscaasrswamawfrqapgkerefvakisgdgrlttygdsvk grftisrdnaeylvylqmdslkpedtavyycaaddnyvtaswrsgpdywgqgtqvtvss
Timeline for d3qxwc_:
![]() Domains from other chains: (mouse over for more information) d3qxwa_, d3qxwb_, d3qxwd_, d3qxwe_ |