SCOPe 2.06: Domain d3qxwe_: 3qxw E:

Lineage for d3qxwe_ (3qxw E:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (22 species)
   not a true protein

7. Species Llama (Lama glama) [TaxId:9844] [187485] (138 PDB entries)

8. Domain d3qxwe_: 3qxw E: [227340]
   automated match to d3qxve_
   complexed with na, so4

Details for d3qxwe_

PDB Entry: 3qxw, 1.85 Å

PDB Description: free structure of an anti-methotrexate cdr1-4 graft vhh antibody

PDB Compounds: (E:) Anti-Methotrexate CDR1-4 Graft VHH

SCOPe Domain Sequences for d3qxwe_:

Sequence; same for both SEQRES and ATOM records:

>d3qxwe_ b.1.1.1 (E:) automated matches {Llama (Lama glama) [TaxId: 9844]}
qvqlvesggglvqaggslrlscaasrrssrswamawfrqapgkerefvakisgdgrltty
gdsvkgrftisrdnaeylvylqmdslkpedtavyycaaddnyvtaswrsgpdywgqgtqv
tvss

Timeline for d3qxwe_:

• d3qxwe_ first appeared in SCOPe 2.03
  
• d3qxwe_ appears in SCOPe 2.05
  
• d3qxwe_ appears in SCOPe 2.07
  
• d3qxwe_ appears in the current release, SCOPe 2.08