SCOPe 2.08: Domain d1eoba_: 1eob A:

Lineage for d1eoba_ (1eob A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.3: Prealbumin-like [49451] (8 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.6: Aromatic compound dioxygenase [49482] (2 families)

5. Family b.3.6.1: Aromatic compound dioxygenase [49483] (5 proteins)
   sandwich; 9 strands in 2 sheets

6. Protein Protocatechuate-3,4-dioxygenase, alpha chain [49486] (2 species)
   alpha and beta chains are derived from a single-chain protomer and share this fold

7. Species Acinetobacter calcoaceticus, adp1 [TaxId:471] [49488] (6 PDB entries)

8. Domain d1eoba_: 1eob A: [22734]
   Other proteins in same PDB: d1eobb_
   complexed with dhb, fe

Details for d1eoba_

PDB Entry: 1eob, 2.2 Å

PDB Description: crystal structure of acinetobacter sp. adp1 protocatechuate 3,4- dioxygenase in complex with 3,4-dihydroxybenzoate

PDB Compounds: (A:) protocatechuate 3,4-dioxygenase alpha chain

SCOPe Domain Sequences for d1eoba_:

Sequence; same for both SEQRES and ATOM records:

>d1eoba_ b.3.6.1 (A:) Protocatechuate-3,4-dioxygenase, alpha chain {Acinetobacter calcoaceticus, adp1 [TaxId: 471]}
elketpsqtggpyvhigllpkqanievfehnldnnlvqdntqgqrirlegqvfdglglpl
rdvlieiwqadtngvypsqadtqgkqvdpnflgwgrtgadfgtgfwsfntikpgavpgrk
gstqaphisliifarginiglhtrvyfddeaeanakdpvlnsiewatrrqtlvakreerd
gevvyrfdiriqgenetvffdi

Timeline for d1eoba_:

• d1eoba_ first appeared (with stable ids) in SCOP 1.55
  
• d1eoba_ appears in SCOPe 2.07