Lineage for d1eoba_ (1eob A:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.3: Prealbumin-like [49451] (8 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. Superfamily b.3.6: Aromatic compound dioxygenase [49482] (2 families) (S)
  5. Family b.3.6.1: Aromatic compound dioxygenase [49483] (5 proteins)
    sandwich; 9 strands in 2 sheets
  6. Protein Protocatechuate-3,4-dioxygenase, alpha chain [49486] (2 species)
    alpha and beta chains are derived from a single-chain protomer and share this fold
  7. Species Acinetobacter calcoaceticus, adp1 [TaxId:471] [49488] (6 PDB entries)
  8. Domain d1eoba_: 1eob A: [22734]
    Other proteins in same PDB: d1eobb_
    complexed with dhb, fe

Details for d1eoba_

PDB Entry: 1eob (more details), 2.2 Å

PDB Description: crystal structure of acinetobacter sp. adp1 protocatechuate 3,4- dioxygenase in complex with 3,4-dihydroxybenzoate
PDB Compounds: (A:) protocatechuate 3,4-dioxygenase alpha chain

SCOPe Domain Sequences for d1eoba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eoba_ b.3.6.1 (A:) Protocatechuate-3,4-dioxygenase, alpha chain {Acinetobacter calcoaceticus, adp1 [TaxId: 471]}
elketpsqtggpyvhigllpkqanievfehnldnnlvqdntqgqrirlegqvfdglglpl
rdvlieiwqadtngvypsqadtqgkqvdpnflgwgrtgadfgtgfwsfntikpgavpgrk
gstqaphisliifarginiglhtrvyfddeaeanakdpvlnsiewatrrqtlvakreerd
gevvyrfdiriqgenetvffdi

SCOPe Domain Coordinates for d1eoba_ are not available.

Timeline for d1eoba_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1eobb_