SCOPe 2.08: Domain d3sbwa_: 3sbw A:

Lineage for d3sbwa_ (3sbw A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Programmed cell death protein 1, PD1, extracellular domain [101510] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [101511] (5 PDB entries)

8. Domain d3sbwa_: 3sbw A: [227336]
   automated match to d3bp6a_
   mutant

Details for d3sbwa_

PDB Entry: 3sbw, 2.28 Å

PDB Description: crystal structure of the complex between the extracellular domains of mouse pd-1 mutant and human pd-l1

PDB Compounds: (A:) Programmed cell death protein 1

SCOPe Domain Sequences for d3sbwa_:

Sequence; same for both SEQRES and ATOM records:

>d3sbwa_ b.1.1.1 (A:) Programmed cell death protein 1, PD1, extracellular domain {Mouse (Mus musculus) [TaxId: 10090]}
sltfypawltvseganatftcslsnwsedlmlnwnrlspsnqtekqaafsnglsqpvqda
rfqiiqlpnrhdfhmnildtrrndsgiylcgaislhpklkieespgaelvvt

Timeline for d3sbwa_:

• d3sbwa_ first appeared in SCOPe 2.03
  
• d3sbwa_ appears in SCOPe 2.07