Lineage for d3qxub_ (3qxu B:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1287435Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1289963Protein automated matches [190119] (16 species)
    not a true protein
  7. 1290216Species Llama (Lama glama) [TaxId:9844] [187485] (60 PDB entries)
  8. 1290247Domain d3qxub_: 3qxu B: [227333]
    automated match to d3qxta_
    complexed with fmt

Details for d3qxub_

PDB Entry: 3qxu (more details), 1.8 Å

PDB Description: Free Structure of an Anti-Methotrexate CDR1-3 Graft VHH Antibody
PDB Compounds: (B:) Anti-Methotrexate CDR1-3 Graft

SCOPe Domain Sequences for d3qxub_:

Sequence, based on SEQRES records: (download)

>d3qxub_ b.1.1.1 (B:) automated matches {Llama (Lama glama) [TaxId: 9844]}
qvqlvesggglvqaggslrlscaasrrssrswamawfrqapgkerefvakisgdgrltty
gdsvkgrftisrdkgkntvylqmdslkpedtavyycaaddnyvtaswrsgpdywgqgtqv
tvss

Sequence, based on observed residues (ATOM records): (download)

>d3qxub_ b.1.1.1 (B:) automated matches {Llama (Lama glama) [TaxId: 9844]}
qvqlvesggglvqaggslrlscaasrrsswamawfrqapgkerefvakisgdgrlttygd
svkgrftisrdkgkntvylqmdslkpedtavyycaaddnyvtaswrsgpdywgqgtqvtv
ss

SCOPe Domain Coordinates for d3qxub_:

Click to download the PDB-style file with coordinates for d3qxub_.
(The format of our PDB-style files is described here.)

Timeline for d3qxub_: