Lineage for d3qxub_ (3qxu B:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2344610Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 protein domains)
  6. 2347168Protein automated matches [190119] (19 species)
    not a true protein
  7. 2347651Species Llama (Lama glama) [TaxId:9844] [187485] (145 PDB entries)
  8. 2347682Domain d3qxub_: 3qxu B: [227333]
    automated match to d3qxta_
    complexed with fmt

Details for d3qxub_

PDB Entry: 3qxu (more details), 1.8 Å

PDB Description: Free Structure of an Anti-Methotrexate CDR1-3 Graft VHH Antibody
PDB Compounds: (B:) Anti-Methotrexate CDR1-3 Graft

SCOPe Domain Sequences for d3qxub_:

Sequence, based on SEQRES records: (download)

>d3qxub_ b.1.1.1 (B:) automated matches {Llama (Lama glama) [TaxId: 9844]}
qvqlvesggglvqaggslrlscaasrrssrswamawfrqapgkerefvakisgdgrltty
gdsvkgrftisrdkgkntvylqmdslkpedtavyycaaddnyvtaswrsgpdywgqgtqv
tvss

Sequence, based on observed residues (ATOM records): (download)

>d3qxub_ b.1.1.1 (B:) automated matches {Llama (Lama glama) [TaxId: 9844]}
qvqlvesggglvqaggslrlscaasrrsswamawfrqapgkerefvakisgdgrlttygd
svkgrftisrdkgkntvylqmdslkpedtavyycaaddnyvtaswrsgpdywgqgtqvtv
ss

SCOPe Domain Coordinates for d3qxub_:

Click to download the PDB-style file with coordinates for d3qxub_.
(The format of our PDB-style files is described here.)

Timeline for d3qxub_: