Lineage for d3gc3b1 (3gc3 B:3-330)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2065823Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2066258Superfamily b.69.6: Clathrin heavy-chain terminal domain [50989] (1 family) (S)
  5. 2066259Family b.69.6.1: Clathrin heavy-chain terminal domain [50990] (2 protein domains)
  6. 2066260Protein Clathrin heavy-chain terminal domain [50991] (1 species)
  7. 2066261Species Norway rat (Rattus norvegicus) [TaxId:10116] [50992] (5 PDB entries)
  8. 2066262Domain d3gc3b1: 3gc3 B:3-330 [227326]
    Other proteins in same PDB: d3gc3a1, d3gc3a2, d3gc3b2
    automated match to d1utcb2

Details for d3gc3b1

PDB Entry: 3gc3 (more details), 2.2 Å

PDB Description: Crystal Structure of Arrestin2S and Clathrin
PDB Compounds: (B:) Clathrin heavy chain 1

SCOPe Domain Sequences for d3gc3b1:

Sequence, based on SEQRES records: (download)

>d3gc3b1 b.69.6.1 (B:3-330) Clathrin heavy-chain terminal domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
qilpirfqehlqlqnlginpanigfstltmesdkficirekvgeqaqvviidmndpsnpi
rrpisadsaimnpaskvialkagktlqifniemkskmkahtmtddvtfwkwislntvalv
tdnavyhwsmegesqpvkmfdrhsslagcqiinyrtdakqkwllltgisaqqnrvvgamq
lysvdrkvsqpieghaasfaqfkmegnaeestlfcfavrgqaggklhiievgtpptgnqp
fpkkavdvffppeaqndfpvamqisekhdvvflitkygyihlydletgtciymnrisget
ifvtapheatagiigvnrkgqvlsvcve

Sequence, based on observed residues (ATOM records): (download)

>d3gc3b1 b.69.6.1 (B:3-330) Clathrin heavy-chain terminal domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
qilpirfqehlqlqnlginpanigfstltmesdkficirekgaqvviidmndpsnpirrp
isadsaimnpaskvialkagktlqifniemkskmkahtmtddvtfwkwislntvalvtdn
avyhwsmegesqpvkmfdrhsslagcqiinyrtdakqkwllltgisaqrvvgamqlysvd
rkvsqpieghaasfaqfkmegnaeestlfcfavrgqaggklhiievgtpptgnqpfpkka
vdvffppeaqndfpvamqisekhdvvflitkygyihlydletgtciymnrisgetifvta
pheatagiigvnrkgqvlsvcve

SCOPe Domain Coordinates for d3gc3b1:

Click to download the PDB-style file with coordinates for d3gc3b1.
(The format of our PDB-style files is described here.)

Timeline for d3gc3b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3gc3b2