SCOPe 2.03: Domain d2zonc2: 2zon C:160-335

Lineage for d2zonc2 (2zon C:160-335)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.3: Multidomain cupredoxins [49550] (8 proteins)

6. Protein Nitrite reductase, NIR [49551] (5 species)
   consists of two domains of this fold

7. Species Alcaligenes xylosoxidans [TaxId:85698] [49554] (25 PDB entries)
   Uniprot O68601 25-360 ! Uniprot O68601 26-359 ! Uniprot O68601

8. Domain d2zonc2: 2zon C:160-335 [227325]
   automated match to d2vw6b2
   complexed with cu, hem

Details for d2zonc2

PDB Entry: 2zon, 1.7 Å

PDB Description: Crystal structure of electron transfer complex of nitrite reductase with cytochrome c

PDB Compounds: (C:) dissimilatory copper-containing nitrite reductase

SCOPe Domain Sequences for d2zonc2:

Sequence; same for both SEQRES and ATOM records:

>d2zonc2 b.6.1.3 (C:160-335) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]}
qgkplhydraytigefdlyipkgpdgkykdyatlaesygdtvqvmrtltpshivfngkvg
altganaltakvgetvllihsqanrdtrphligghgdwvwetgkfanppqrdletwfirg
gsagaalytfkqpgvyaylnhnlieafelgaaghikvegkwnddlmkqikapapip

Timeline for d2zonc2:

• d2zonc2 is new in SCOPe 2.03-stable
  
• d2zonc2 appears in SCOPe 2.04
  
• d2zonc2 appears in the current release, SCOPe 2.08