Lineage for d2zonb2 (2zon B:160-335)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2036241Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2036242Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2036937Family b.6.1.3: Multidomain cupredoxins [49550] (8 protein domains)
  6. 2037154Protein Nitrite reductase, NIR [49551] (5 species)
    consists of two domains of this fold
  7. 2037373Species Alcaligenes xylosoxidans [TaxId:85698] [49554] (24 PDB entries)
    Uniprot O68601 25-360 ! Uniprot O68601 26-359 ! Uniprot O68601
  8. 2037391Domain d2zonb2: 2zon B:160-335 [227323]
    Other proteins in same PDB: d2zong_
    automated match to d2vw6b2
    complexed with cu, hem

Details for d2zonb2

PDB Entry: 2zon (more details), 1.7 Å

PDB Description: Crystal structure of electron transfer complex of nitrite reductase with cytochrome c
PDB Compounds: (B:) dissimilatory copper-containing nitrite reductase

SCOPe Domain Sequences for d2zonb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zonb2 b.6.1.3 (B:160-335) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]}
qgkplhydraytigefdlyipkgpdgkykdyatlaesygdtvqvmrtltpshivfngkvg
altganaltakvgetvllihsqanrdtrphligghgdwvwetgkfanppqrdletwfirg
gsagaalytfkqpgvyaylnhnlieafelgaaghikvegkwnddlmkqikapapip

SCOPe Domain Coordinates for d2zonb2:

Click to download the PDB-style file with coordinates for d2zonb2.
(The format of our PDB-style files is described here.)

Timeline for d2zonb2: