SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2zonb2 (2zon B:160-335)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2036241Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2036242Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2036937Family b.6.1.3: Multidomain cupredoxins [49550] (8 protein domains)
  6. 2037154Protein Nitrite reductase, NIR [49551] (5 species)
    consists of two domains of this fold
  7. 2037373Species Alcaligenes xylosoxidans [TaxId:85698] [49554] (24 PDB entries)
    Uniprot O68601 25-360 ! Uniprot O68601 26-359 ! Uniprot O68601
  8. 2037391Domain d2zonb2: 2zon B:160-335 [227323]
    Other proteins in same PDB: d2zong_
    automated match to d2vw6b2
    complexed with cu, hem

Details for d2zonb2

PDB Entry: 2zon (more details), 1.7 Å

PDB Description: Crystal structure of electron transfer complex of nitrite reductase with cytochrome c
PDB Compounds: (B:) dissimilatory copper-containing nitrite reductase

SCOPe Domain Sequences for d2zonb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zonb2 b.6.1.3 (B:160-335) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]}
qgkplhydraytigefdlyipkgpdgkykdyatlaesygdtvqvmrtltpshivfngkvg
altganaltakvgetvllihsqanrdtrphligghgdwvwetgkfanppqrdletwfirg
gsagaalytfkqpgvyaylnhnlieafelgaaghikvegkwnddlmkqikapapip

SCOPe Domain Coordinates for d2zonb2:

Click to download the PDB-style file with coordinates for d2zonb2.
(The format of our PDB-style files is described here.)

Timeline for d2zonb2: