SCOP 1.69: Domain d1eoaa_: 1eoa A:

Lineage for d1eoaa_ (1eoa A:)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.3: Prealbumin-like [49451] (6 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.6: Aromatic compound dioxygenase [49482] (1 family)

5. Family b.3.6.1: Aromatic compound dioxygenase [49483] (4 proteins)
   sandwich; 9 strands in 2 sheets

6. Protein Protocatechuate-3,4-dioxygenase, alpha chain [49486] (2 species)
   alpha and beta chains are derived from a single-chain protomer and share this fold

7. Species Acinetobacter calcoaceticus, adp1 [TaxId:471] [49488] (5 PDB entries)

8. Domain d1eoaa_: 1eoa A: [22732]
   Other proteins in same PDB: d1eoab_

Details for d1eoaa_

PDB Entry: 1eoa, 2.15 Å

PDB Description: crystal structure of acinetobacter sp. adp1 protocatechuate 3,4- dioxygenase in complex with cyanide

SCOP Domain Sequences for d1eoaa_:

Sequence; same for both SEQRES and ATOM records:

>d1eoaa_ b.3.6.1 (A:) Protocatechuate-3,4-dioxygenase, alpha chain {Acinetobacter calcoaceticus, adp1}
elketpsqtggpyvhigllpkqanievfehnldnnlvqdntqgqrirlegqvfdglglpl
rdvlieiwqadtngvypsqadtqgkqvdpnflgwgrtgadfgtgfwsfntikpgavpgrk
gstqaphisliifarginiglhtrvyfddeaeanakdpvlnsiewatrrqtlvakreerd
gevvyrfdiriqgenetvffdi

Timeline for d1eoaa_:

• d1eoaa_ first appeared (with stable ids) in SCOP 1.55
  
• d1eoaa_ appears in SCOP 1.67
  
• d1eoaa_ appears in SCOP 1.71
  
• d1eoaa_ appears in the current release, SCOPe 2.08