Lineage for d2nyya4 (2nyy A:1094-1295)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2791605Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2792430Superfamily b.42.4: STI-like [50386] (3 families) (S)
  5. 2792493Family b.42.4.2: Clostridium neurotoxins, C-terminal domain [50399] (3 proteins)
    overall fold is very similar to that of the STI family
    automatically mapped to Pfam PF07951
  6. 2792494Protein Botulinum neurotoxin [50402] (2 species)
  7. 2792495Species Clostridium botulinum, serotype A [TaxId:1491] [50403] (10 PDB entries)
  8. 2792505Domain d2nyya4: 2nyy A:1094-1295 [227310]
    Other proteins in same PDB: d2nyya1, d2nyya2, d2nyya3, d2nyyc1, d2nyyc2, d2nyyd1, d2nyyd2, d2nyyd3
    automated match to d3btaa2
    complexed with ca, zn

Details for d2nyya4

PDB Entry: 2nyy (more details), 2.61 Å

PDB Description: crystal structure of botulinum neurotoxin type a complexed with monoclonal antibody cr1
PDB Compounds: (A:) Botulinum neurotoxin type A

SCOPe Domain Sequences for d2nyya4:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nyya4 b.42.4.2 (A:1094-1295) Botulinum neurotoxin {Clostridium botulinum, serotype A [TaxId: 1491]}
sgilkdfwgdylqydkpyymlnlydpnkyvdvnnvgirgymylkgprgsvmttniylnss
lyrgtkfiikkyasgnkdnivrnndrvyinvvvknkeyrlatnasqagvekilsaleipd
vgnlsqvvvmkskndqgitnkckmnlqdnngndigfigfhqfnniaklvasnwynrqier
ssrtlgcswefipvddgwgerp

SCOPe Domain Coordinates for d2nyya4:

Click to download the PDB-style file with coordinates for d2nyya4.
(The format of our PDB-style files is described here.)

Timeline for d2nyya4: