Lineage for d1eo9a_ (1eo9 A:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.3: Prealbumin-like [49451] (6 superfamilies) 
Superfamily b.3.6: Aromatic compound dioxygenase [49482] (1 family) 
Family b.3.6.1: Aromatic compound dioxygenase [49483] (3 proteins) 
Protein Protocatechuate-3,4-dioxygenase, alpha chain [49486] (2 species) Species Acinetobacter calcoaceticus, adp1 [TaxId:471] [49488] (5 PDB entries) 
Domain d1eo9a_: 1eo9 A: [22731]
Other proteins in same PDB: d1eo9b_
Details for d1eo9a_
PDB Entry: 1eo9 (more details), 2 Å
PDB Description: crystal structure of acinetobacter sp. adp1 protocatechuate 3,4- dioxygenase at ph < 7.0
SCOP Domain Sequences for d1eo9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eo9a_ b.3.6.1 (A:) Protocatechuate-3,4-dioxygenase, alpha chain {Acinetobacter calcoaceticus, adp1}
elketpsqtggpyvhigllpkqanievfehnldnnlvqdntqgqrirlegqvfdglslpl
rdvlieiwqadtngvypsqadtqgkqvdpnflgwgrtgadfgtgfwsfntikpgavpgrk
gstqaphisliifarginiglhtrvyfddeaeanakdpvlnsiewatrrqtlvakreerd
gevvyrfdiriqgenetvffdi
SCOP Domain Coordinates for d1eo9a_:
Click to download the PDB-style file with coordinates for d1eo9a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1eo9a_:
- d1eo9a_ appears in SCOP 1.57
- d1eo9a_ appears in the current release, SCOPe 2.08
View in 3D
