| Class b: All beta proteins [48724] (180 folds) |
| Fold b.3: Prealbumin-like [49451] (8 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
Superfamily b.3.6: Aromatic compound dioxygenase [49482] (2 families) ![]() |
| Family b.3.6.1: Aromatic compound dioxygenase [49483] (5 proteins) sandwich; 9 strands in 2 sheets |
| Protein Protocatechuate-3,4-dioxygenase, alpha chain [49486] (2 species) alpha and beta chains are derived from a single-chain protomer and share this fold |
| Species Acinetobacter calcoaceticus, adp1 [TaxId:471] [49488] (6 PDB entries) |
| Domain d1eo9a_: 1eo9 A: [22731] Other proteins in same PDB: d1eo9b_ complexed with fe, so4 |
PDB Entry: 1eo9 (more details), 2 Å
SCOPe Domain Sequences for d1eo9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eo9a_ b.3.6.1 (A:) Protocatechuate-3,4-dioxygenase, alpha chain {Acinetobacter calcoaceticus, adp1 [TaxId: 471]}
elketpsqtggpyvhigllpkqanievfehnldnnlvqdntqgqrirlegqvfdglslpl
rdvlieiwqadtngvypsqadtqgkqvdpnflgwgrtgadfgtgfwsfntikpgavpgrk
gstqaphisliifarginiglhtrvyfddeaeanakdpvlnsiewatrrqtlvakreerd
gevvyrfdiriqgenetvffdi
Timeline for d1eo9a_: