Lineage for d2nyya3 (2nyy A:873-1079)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1307103Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 1307104Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 1308255Family b.29.1.6: Clostridium neurotoxins, the second last domain [49956] (3 proteins)
    automatically mapped to Pfam PF07953
  6. 1308256Protein Botulinum neurotoxin [49959] (2 species)
  7. 1308257Species Clostridium botulinum, serotype A [TaxId:1491] [49960] (3 PDB entries)
  8. 1308260Domain d2nyya3: 2nyy A:873-1079 [227309]
    Other proteins in same PDB: d2nyya1, d2nyya2, d2nyya4
    automated match to d3btaa1
    complexed with ca, zn

Details for d2nyya3

PDB Entry: 2nyy (more details), 2.61 Å

PDB Description: crystal structure of botulinum neurotoxin type a complexed with monoclonal antibody cr1
PDB Compounds: (A:) Botulinum neurotoxin type A

SCOPe Domain Sequences for d2nyya3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nyya3 b.29.1.6 (A:873-1079) Botulinum neurotoxin {Clostridium botulinum, serotype A [TaxId: 1491]}
iintsilnlryesnhlidlsryaskinigskvnfdpidknqiqlfnlesskievilknai
vynsmyenfstsfwiripkyfnsislnneytiincmennsgwkvslnygeiiwtlqdtqe
ikqrvvfkysqminisdyinrwifvtitnnrlnnskiyingrlidqkpisnlgnihasnn
imfkldgcrdthryiwikyfnlfdkel

SCOPe Domain Coordinates for d2nyya3:

Click to download the PDB-style file with coordinates for d2nyya3.
(The format of our PDB-style files is described here.)

Timeline for d2nyya3: