Lineage for d3pcld_ (3pcl D:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1772695Fold b.3: Prealbumin-like [49451] (7 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 1773641Superfamily b.3.6: Aromatic compound dioxygenase [49482] (2 families) (S)
  5. 1773642Family b.3.6.1: Aromatic compound dioxygenase [49483] (5 proteins)
    sandwich; 9 strands in 2 sheets
  6. 1773665Protein Protocatechuate-3,4-dioxygenase, alpha chain [49486] (2 species)
    alpha and beta chains are derived from a single-chain protomer and share this fold
  7. 1773673Species Pseudomonas putida [TaxId:303] [49487] (36 PDB entries)
  8. 1773812Domain d3pcld_: 3pcl D: [22716]
    Other proteins in same PDB: d3pclm_, d3pcln_, d3pclo_, d3pclp_, d3pclq_, d3pclr_
    complexed with cyn, fe, ino

Details for d3pcld_

PDB Entry: 3pcl (more details), 2.15 Å

PDB Description: structure of protocatechuate 3,4-dioxygenase complexed with 2-hydroxyisonicotinic acid n-oxide and cyanide
PDB Compounds: (D:) protocatechuate 3,4-dioxygenase

SCOPe Domain Sequences for d3pcld_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pcld_ b.3.6.1 (D:) Protocatechuate-3,4-dioxygenase, alpha chain {Pseudomonas putida [TaxId: 303]}
piellpetpsqtagpyvhiglaleaagnptrdqeiwnrlakpdapgehilllgqvydgng
hlvrdsflevwqadangeyqdaynlenafnsfgrtattfdagewtlhtvkpgvvnnaagv
pmaphinislfarginihlhtrlyfddeaqanakcpvlnlieqpqrretliakrcevdgk
tayrfdiriqgegetvffdf

SCOPe Domain Coordinates for d3pcld_:

Click to download the PDB-style file with coordinates for d3pcld_.
(The format of our PDB-style files is described here.)

Timeline for d3pcld_: