Lineage for d3pclc_ (3pcl C:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 55519Fold b.3: Prealbumin-like [49451] (6 superfamilies)
  4. 55707Superfamily b.3.6: Aromatic compound dioxygenase [49482] (1 family) (S)
  5. 55708Family b.3.6.1: Aromatic compound dioxygenase [49483] (3 proteins)
  6. 55719Protein Protocatechuate-3,4-dioxygenase, alpha chain [49486] (2 species)
  7. 55726Species Pseudomonas aeruginosa [TaxId:287] [49487] (15 PDB entries)
  8. 55801Domain d3pclc_: 3pcl C: [22715]
    Other proteins in same PDB: d3pclm_, d3pcln_, d3pclo_, d3pclp_, d3pclq_, d3pclr_

Details for d3pclc_

PDB Entry: 3pcl (more details), 2.15 Å

PDB Description: structure of protocatechuate 3,4-dioxygenase complexed with 2-hydroxyisonicotinic acid n-oxide and cyanide

SCOP Domain Sequences for d3pclc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pclc_ b.3.6.1 (C:) Protocatechuate-3,4-dioxygenase, alpha chain {Pseudomonas aeruginosa}
piellpetpsqtagpyvhiglaleaagnptrdqeiwnrlakpdapgehilllgqvydgng
hlvrdsflevwqadangeyqdaynlenafnsfgrtattfdagewtlhtvkpgvvnnaagv
pmaphinislfarginihlhtrlyfddeaqanakcpvlnlieqpqrretliakrcevdgk
tayrfdiriqgegetvffdf

SCOP Domain Coordinates for d3pclc_:

Click to download the PDB-style file with coordinates for d3pclc_.
(The format of our PDB-style files is described here.)

Timeline for d3pclc_: